Last updated · traffic data through Jun 2026 - refreshes automatically as new data lands.
Chimney Sweep is one of 3,112 topics Site Stats Database classifies sites into, based on each site's content, metadata, and on-page signals.
321
Websites
0.1%
Share of all tracked
#942
Rank
of 3,112 topics
5
Median DR
822,342
Combined monthly traffic
Showing 12 of 321 results
309 more chimney sweep websites are hidden. Unlock the full list.
Site Stats Database tracks 321 chimney sweep websites. They carry a median Ahrefs Domain Rating of 5, lower than the 28 median across all tracked sites. The typical one is about 13 years old and ranks for 234 organic keywords. Notable Chimney Sweep sites include lindemannchimneysupply.com, fullservicechimney.com, chimneysweepsinc.com. See plans and pricing.
Every figure here is based only on the 321 chimney sweep websites Site Stats Database tracks, not the entire web.
Dimension
Top market
Top related topic
Median referring domains
98
Median keywords
234
Median domain age
13 yrs
Adoption by audience size
Share of the most-visited sites we track that are chimney sweep websites.
0%
Top 10K
0 of 10,000
<0.1%
Top 100K
1 of 100,000
<0.1%
All tracked
321 of 880,858
Site Stats Database tracks 321 chimney sweep websites, enriched with full monthly traffic history, authority, keywords, referring domains, and the complete detected tech stack. Everything refreshes at least monthly.
Site Stats Database currently tracks 321 chimney sweep websites. We detect this by analyzing each site's homepage, response headers, and DNS, then enrich every record with traffic and authority data.
By number of sites, Chimney Sweep is #942 of 3,112 topics & industries that Site Stats Database tracks.
The most common topics among them are Chimney, Repair, and Fireplace, and they are most common in United States and India. The breakdowns above show the full split, based on the 321 we track.
They tend to have lower authority than the typical website: the median Chimney Sweep site has an Ahrefs Domain Rating of 5, lower than the 28 median across all sites Site Stats Database tracks.
Traffic estimates, organic keywords, and authority come from DataForSEO; Domain Rating comes from Ahrefs' public endpoint; and the topic, market, and tech detections come from Site Stats Database's own crawler, which inspects each site's HTML, headers, DNS, and TLS certificate.
At least monthly. Traffic and rankings refresh every month, and detections refresh as sites are re-crawled, so this page always reflects the current 321 chimney sweep websites.
Yes. The complete, filterable list of all 321 chimney sweep websites, enriched with traffic history, authority, keywords, and the full tech stack, is available with a Site Stats Database plan.
Site Stats Database classifies each site into topics from its content, metadata, and on-page signals, then enriches every record with traffic and authority data.
Citation
Site Stats Database. "Top Chimney Sweep Websites." Site Stats Database, July 1, 2026. https://sitestatsdb.com/topics/chimney-sweep
| English |
| 45 |
| 6,056 |
| 1,454 |
| 21 yrs |
| 50,636 |
| chimneysweepsinc.com | English | 6 | 1,621 | 227 | 13 yrs | 23,800 |
| chimcare.com | English | 32 | 4,839 | 454 | 14 yrs | 23,344 |
| chimneysolutions.com | English | 41 | 3,634 | 897 | 26 yrs | 22,279 |
| highschimney.com | English | 32 | 2,262 | 1,080 | 26 yrs | 20,916 |
| madhatterindy.com | English | 8 | 699 | 143 | 21 yrs | 20,772 |
| thechimneysweep.com | English | 8 | 634 | 138 | 27 yrs | 14,621 |
| cleansweepchimneyservicesllc.com | English | 16 | 80 | 72 | 15 yrs | 13,899 |
| midtownsweeps.com | English | 36 | 2,340 | 615 | 17 yrs | 13,583 |
| mychimney.com | Hindi | 37 | 3,286 | 996 | 21 yrs | 12,082 |
| johnson-chimneysweep.com | English | 1.9 | 669 | 62 | 2 yrs | 9,787 |